****************************************************************************** RefSeq-release23.txt ftp://ftp.ncbi.nih.gov/refseq/release/release-notes/ NCBI Reference Sequence (RefSeq) Database Release 23 May 8, 2007 Distribution Release Notes Release Size: 4300 organisms, 83148327110 nucleotide bases, 1291050995 amino acids, 5503385 records ------------------------------------------------------------------------ ****************************************************************************** This document describes the format and content of the flat files that comprise releases of the NCBI Reference Sequence (RefSeq) database. Additional information about RefSeq is available at: 1. NCBI Handbook: http://www.ncbi.nlm.nih.gov/books/bv.fcgi?call=bv.View..ShowTOC&rid=handbook.TOC&depth=2 2. RefSeq Web Site: http://www.ncbi.nlm.nih.gov/RefSeq/ If you have any questions or comments about RefSeq, the RefSeq release files or this document, please contact NCBI by email at: info@ncbi.nlm.nih.gov. To receive announcements of future RefSeq releases and large updates please subscribe to NCBI's refseq-announce mail list: send email to refseq-announce-subscribe@ncbi.nlm.nih.gov with "subscribe" in the subject line (without quotes) and nothing in the email body OR subscribe using the web interface at: http://www.ncbi.nlm.nih.gov/mailman/listinfo/refseq-announce ============================================================================= TABLE OF CONTENTS ============================================================================= 1. INTRODUCTION 1.1 Release 23 1.2 Cutoff date 1.3 RefSeq Project Background 1.3.1 Sequence accessions, validation, and annotations 1.3.2 Data assembly, curation, and collaboration 1.3.3 Biologically non-redundant data set 1.3.4 RefSeq and DDBJ/EMBL/GenBank comparison 1.4 Uses and applications of the RefSeq database 2. CONTENT 2.1 Organisms included 2.2 Molecule Types included 2.3 Known Problems, Redundancies, and Inconsistencies 2.4 Last genome update for select major organisms 2.5 Release Catalog 2.6 Changes since the previous release 3. ORGANIZATION OF DATA FILES 3.1 FTP Site Organization 3.2 Release Contents 3.3 File Names and Formats 3.4 File Sizes 3.5 Statistics 3.6 Release Catalog 3.7 Removed Records 3.8 Accession Format 3.9 Growth of RefSeq 4. FLAT FILE ANNOTATION 4.1 Main features of RefSeq Flat File 4.1.1 LOCUS, DEFLINE, ACCESSION, KEYWORDS, SOURCE, ORGANISM 4.1.2 REFERENCE, DIRECT SUBMISSION, COMMENT 4.1.3 FEATURE ANNOTATION (Gene, mRNA, CDS, Variation, Protein) 4.2 Tracking Identifiers 4.2.1 GeneID 4.2.2 Transcript ID 4.2.3 Protein ID 4.2.4 Conserved Domain Database (CDD) ID 5. REFSEQ ADMINISTRATION 5.1 Citing RefSeq 5.2 RefSeq Distribution Formats 5.3 Other Methods of Accessing RefSeq Data 5.4 Request for Corrections and Comments 5.5 Credits and Acknowledgements 5.6 Disclaimer ============================================================================= 1. INTRODUCTION ============================================================================= The NCBI Reference Sequence Project (RefSeq) is an effort to provide the best single collection of naturally occurring biomolecules, representative of the central dogma, for each major organism. Ideally this would include one sequence record for each chromosome, organelle, or plasmid linked on a residue by residue basis to the expressed transcripts, to the translated proteins, and to each mature peptide product. Depending on the organism, we may have some, but not all, of this information at any given time. We pragmatically include the best view we can from available data. Additional information about the RefSeq project is available from: a) RefSeq Web site http://www.ncbi.nlm.nih.gov/RefSeq/ b) Entrez Books, NCBI Handbook, RefSeq chapter http://www.ncbi.nlm.nih.gov/books/bv.fcgi?rid=handbook.chapter.ch18 1.1 Release 23 -------------- The National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), National Institutes of Health (NIH) is responsible for producing and distributing the RefSeq Sequence Database. Records are provided through a combination of collaboration and in-house processing including some curation by NCBI staff comprised of expert biologists. RefSeq release 23 is a full release of all NCBI RefSeq records. The RefSeq project is an ongoing effort to provide a curated, non-redundant collection of sequences. This release includes all of the sequence data that we have collected at this time. Although the RefSeq collection is not yet complete, its value as a non-redundant dataset has reached a level that justifies providing full releases. 1.2 Cutoff date --------------- This full release, release 23, incorporates data available as of May 8th, 2007. For more recent data, users are advised to: . 1. Download the RefSeq daily update files from the RefSeq FTP site ftp://ftp.ncbi.nih.gov/refseq/daily/ 2. Use NCBI's Entrez Programming Utilities to dowload records based on queries or lists of accessions http://www.ncbi.nlm.nih.gov/entrez/query/static/eutils_help.html . 3. Use the interactive web Entrez Query systems to query based on date. http://www.ncbi.nlm.nih.gov/entrez/ 1.3 RefSeq Project Background ----------------------------- 1.3.1 Sequence accessions, validation, and annotation ----------------------------------------------------- Every sequence is assigned a stable accession, version, and gi and all older versions remain available over time. RefSeq accessions have a distinct format (see section 3.6); the underscore ("_") is the primary distinguishing feature of a RefSeq accession. DDBJ/EMBL/GenBank accessions never include an underscore. Sequences are validated in several ways. For example, to confirm that genomic sequence from the region of the mRNA feature really does match the mRNA sequence itself, and that the annotated coding region features really can be translated into the protein sequences they refer to. Validation also checks for valid ASN.1 format. Validation also ensures that consistency is maintained in descriptive information (symbols, gene and protein names) between RefSeq and Gene records. Each molecule is annotated as accurately as possible with the correct organism name, the correct gene symbol for that organism, and reasonable names for proteins where possible. When available, nomenclature provided by official nomenclature groups is used. Note that gene symbols are not required or expected to be unique either across species or within a species. 1.3.2 Data assembly, curation, and collaboration ------------------------------------------------ We welcome collaborations with authoritative groups outside NCBI who are willing to provide the sequences, annotations, or links to phenotypic or organism specific resources. Where such collaborations have not yet developed, NCBI staff have assembled the best view of the organism that we can put together ourselves. In some cases, as with the human genome, NCBI is an active participant in generating the genome assembly and in providing reference sequences to represent the annotated genome. For other genomes, we may compile the data ourselves from DDBJ/EMBL/GenBank or other public sources. For instance, we may simply select the "best" DDBJ/EMBL/GenBank record by automatic means, validate the data format (and correct if needed), and add an essentially unchanged copy to the RefSeq collection, attributed to the original DDBJ/EMBL/GenBank record. In other cases we may provide a record that is very similar to the DDBJ/EMBL/GenBank record, but to which experts at NCBI have added corrected or additional annotation. This latter process can range from minor technical repairs to a manually curated re-annotation of the sequence, often in collaboration with experts outside NCBI. Each record that has been curated, or that is in the pool for future curation, is labeled with the level of curation it has received. Curation status information is provided primarily for transcript and protein records. Curation is carried out on the whole genome level for some smaller genomes such as viral, organelle, and some microbial genomes. Curation status codes are defined in the section 3.2 below. 1.3.3 Biologically non-redundant data set ----------------------------------------- RefSeq provides a biologically non-redundant set of sequences for database searching and gene characterization. It has the advantage of providing an objective and experimentally verifiable definition of "non-redundant" in supplying one example of each natural biomolecule per organism. The small amount of sequence redundancy introduced from close paralogs, alternate splicing products, and genome assembly intermediates is compensated for by the clarity of the model. RefSeq provides the substrate for a variety of conclusions about non-redundancy based on clustering identical sequences, or families of related sequences, without confounding the database itself with these more subjective assessments. 1.3.4 RefSeq and DDBJ/EMBL/GenBank comparison --------------------------------------------- RefSeq is unique in providing a large curated database across many organisms, which precisely and explicitly links genetic (chromosome), expression (mRNA), and functional (protein) sequence data into an integrated whole. DDBJ/EMBL/GenBank also integrates DNA and protein information, and RefSeq is substantially based on sequence records contributed to DDBJ/EMBL/GenBank. However, RefSeq is similar to a review article in that it represents a synthesis and summary of information by a particular group (NCBI or other RefSeq contributors) that is based on the primary data gathered by many others and made part of the scientific record. Also, like a review article, it has the advantage of organizing a large body of diverse data into a single consistent framework with a uniform set of conventions and standards. Note that while based on DDBJ/EMBL/GenBank, RefSeq is distinct from DDBJ/EMBL/GenBank. DDBJ/EMBL/GenBank represents the sequence and annotations supplied by the original authors and is never changed by NCBI or RefSeq staff. DDBJ/EMBL/GenBank remains the primary sequence archive while RefSeq is a summary and synthesis based on that essential primary data. 1.4 Uses and applications of the RefSeq database ------------------------------------------------ A stable, consistent, comprehensive, non-redundant database of genomes and their products provides a valuable sequence resource for similarity searching, gene identification, protein classification, comparative genomics, and selection of probes for gene expression. It also acts as molecular "white pages" by providing a single, uniform point of access for searching at the sequence level, and by connecting the results with a diversity of organism-specific databases or resources unique to that organism or field. ============================================================================= 2. CONTENT ============================================================================= 2.1 Organisms included ---------------------- This number of organisms reported for the release (section 3.5 below) is determined by counting the number of distinct tax_ids included in the release. Tax_ids are provided, for all species having any amount of sequence data, by the NCBI Taxonomy group. The release includes species ranging from viral to microbial to eukaryotic and includes organisms for which complete and incomplete genomic sequence data is available. The release does not include all species for which some sequence data is available in DDBJ/EMBL/GenBank. The decision to generate RefSeq data for a species depends in part on the amount of sequence data available. Additional species will be represented in the RefSeq collection as more sequence data becomes available. 2.2 Molecule Types Included --------------------------- The RefSeq release includes genomic, transcript, and protein sequence data; however, these molecule types are not provided for all organisms and the sequences provided may not be complete or comprehensive for some species. Transcript RefSeq records may represent protein-coding transcripts or non-coding RNA products; these records are currently only provided for eukaryotic species. Genomic RefSeq records are provided when a sufficient quantity of genomic sequence data is available in DDBJ/EMBL/GenBank. Transcript and protein records may be provided for a species before genomic sequence data is available, as is the case with Danio rerio (zebrafish). 2.3 Known Problems, Redundancies, and Inconsistencies ------------------------------------------------------ Known Problems with RefSeq release 23: ===================================== . [1] RefSeq release 23 whole genome shotgun (WGS) assemblies of mitochondrial genomes are included in the complete node and in the taxonomic group that the whole genome WGS project is reported in (e.g., fungi etc.). Our process flow for WGS data provides a data extraction per WGS project with no distinction by molecule (such as mitochondrial). Therefore, the mitochondrial node does not include the WGS data for this release. Known Redunancies and Inconsistencies: ====================================== The RefSeq collection is an ongoing project that is expected to grow in scope and content over time. Thus it is important to recognize that it is not complete in that some genomes are not yet completely sequenced, some incompletely sequenced genomes may not be included, or some gene products may not yet be represented. RefSeq records may be added, removed, or updated in future releases as new information becomes available and as a result of curation. Known Data inconsistencies: [1] RefSeq status codes are not consistently provided for some species. The goal is to consistently provide a status code for all RefSeq records. The release catalog indicates "UNKNOWN" if a status code was expected but not detected and "na" if a status code is not expected based on the original project plan for provision of this type of information. Status codes will be more consistently applied to all records in the future. [2] The genomic, transcript, and protein collection is known to be incomplete for many species. This is particularly true for those genomes for which a complete genome assembly is not yet available, such as Danio rerio (zebrafish), Bos taurus (cow), and Leishmania major. As additional sequence data becomes available, the RefSeq representation for these, and other, organisms will increase. [3] Whole genome shotgun (WGS) assemblies of mitochondrial genomes are included in the complete node and in the taxonomic group that the whole genome WGS project is reported in (e.g., fungi etc.). Our process flow for WGS data provides a data extraction per WGS project with no distinction by molecule (such as mitochondrial). Therefore, the mitochondrial node does not include WGS data. [4] Although the goal is to provide a non-redundant collection, some redundancy is included in this release as follows: Redundant Protein records: Alternate Splicing When additional transcripts are provided to represent alternate splicing products, and the alternate splice site occurs in the UTR, then the protein is redundantly provided. Paralogs The goal is to provide a RefSeq record for each naturally occuring molecule. Therefore, records are provided for all genes identified including those produced by more recent gene duplication events in which the genes are nearly identical. Redundant Genomic records: Intermediate records For some species, intermediate genomic records are provided to support the assembly and/or annotation of the genome. For example, for human, a chromosome may be represented by a chromosome RefSeq record with a NC_ accession prefix. The chromosome record may consist of many contigs, each represented as a separate record with a NT_ accession prefix. In addition, some curated gene region records, with NG_ accession prefix, may also be provided to support annotation of complex regions. Alternate assemblies Genomic records are provided to represent alternate assemblies of genomic sequence derived from different populations. These records will have varying levels of redundancy and represent polymorphic and haplotype differences in terms of the sequence and annotation. For example, alternate assemblies are provided for different mouse strains and for regions of the human major histocompatibility complex (MHC). The MHC is a highly variable region of chromosome 6 which exhibits variation at the level of both sequence polymorphism and gene content. The alternate assemblies make it possible to represent this alternate gene content. Microbial strains We are evaluating how to best represent microbial genome sequence data derived from different strains in the RefSeq collection. At this time, sequence from different strains may be represented as additional RefSeq records. This introduces redundancy but may also add representation for some proteins that are unique to a strain. We are planning to introduce a new identifier, a 'project ID', in the near future. The project ID will facilitate identification of this known redundancy. 2.4 Notes on select major organisms ----------------------------------- New organisms added to the RefSeq collection since the previous release are reported in the file: /release-catalog/release##.taxon.new Anopheles gambiae Genomic sequence data is available as whole genome shotgun (WGS). This release includes an annotation update released by Ensembl (Ensembl release 31.2f; NCBI build 2.2). Apis mellifera The assembled genome was provided by Baylor College of Medicine. This release includes the NCBI annotation for assembly Amel_4.0. Arabidopsis thaliana The RefSeq release includes the TAIR7 genome assembly and annotation provided by The Arabidopsis Information Resource. Bos taurus The RefSeq release includes the NCBI annotation of the 7x WGS assembly, Btau_23.1, released by the Baylor College of Medicine. Canis familiaris An updated 7.6X dog genome WGS assembly was release in May 2005 by the Dog Genome Sequencing Consortium. This assembly was annotated by the NCBI genome annotation pipeline (NCBI build 2.1) and is included in this RefSeq release. Caenorhabditis elegans The RefSeq release includes the WS170 version of C. elegans genome assembly and annotation provided by WormBase. Danio rerio This RefSeq release includes the genome assembly Zv6 provided by the Zebrafish Genome Project and the NCBI annotation of this assembly. Dictyostelium discoideum The RefSeq release includes the genome assembly and annotation provided by the international D. discoideum sequencing consortium. Drosophila melanogaster This RefSeq release includes Release 5.0 of the assembled, annotated genome that was provided by FlyBase. Encephalitozoon cuniculi The annotated assembled genome was contributed by Genoscope and the Universite Blasie Pascal. Eremothecium gossypii The annotated assembled genome was contributed by the University of Basel in collaboration with Syngenta. Gallus gallus The assembled genome was provided by the Washington University School of Medicine. This release includes the NCBI Map Viewer annotation build 2.1 (released November 2006). Homo sapiens NCBI provides the human genome assembly in close collaboration with the sequencing centers. This release includes human genome build 36.2. Annotation and map data for human NCBI build 36.2 is available in the Map Viewer FTP site: ftp://ftp.ncbi.nih.gov/genomes/H_sapiens/ The release includes RefSeq chromosomes, contigs, known transcripts and proteins (as defined by having a Gene ID), and derived model transcripts and proteins predicted by the Genome Annotation pipeline. See: http://www.ncbi.nlm.nih.gov/genome/guide/build.html Magnaporthe grisea The assembled annotated WGS genome was provided by the Broad Institute. The release includes genomic, transcript, and protein records. An update was released in April 2007. Mus musculus NCBI provides the mouse genome assembly in close collaboration with the sequencing centers. This RefSeq release includes mouse genome build 36.1. The release includes RefSeq contigs, known transcripts and proteins, and derived model transcripts and proteins predicted by the Genome Annotation pipeline. Neurospora crassa The annotated genome data was supplied by the Whitehead Institute. RefSeqs were first released on July 2, 2003 and include WGS genomic contigs, predicted transcripts, predicted proteins. The RefSeq data does not represent the subset of small WGS contigs that were not mapped to a chromosome position or do not include annotation. Oryza sativa The rice genome assembly and annotation are provided by the International Rice Genome Sequencing Project. Pan troglodytes The chimpanzee genome was assembled by the Broad Institute and the Washington University School of Medicine using the human genome as a guide. The finished 6X assembly was annotated by the NCBI genome annotation pipeline (NCBI build 2.1) and is included in this RefSeq release. Rattus norvegicus NCBI uses the rat whole genome shotgun (WGS) genome assembly provided by Baylor sequencing center. The RefSeq includes rat genome assembly RGSCv3.4, provided by the Rat Genome Sequencing Consortium (RGSC) and an alternate WGS assembly provided by Celera Genomics. RefSeqs include contigs, known transcripts and proteins, and derived model transcripts and proteins predicted by the NCBI Genome Annotation pipeline. Saccharomyces cerevisiae Provided by Sacchraomyces Genome Database (SGD); this release includes the chromosome and protein records updated on April 30, 2007. Schizosaccharomyces pombe Provided by Sacchraomyces Genome Database (SGD); this release includes the chromosome, transcript, and protein records updated on June 20, 2005. Microbial The RefSeq collection includes incomplete WGS microbial genomes for which an accession is provided for each contig; thus, the number of accessions for this category is significantly greater than the number of organisms represented. A current list of complete microbial genomes is available from the NCBI Genome Project database. Microbial genomes are annotated by a collaborative automatic computation method, followed by curation by NCBI staff. Viruses Viral genome records are curated via an extensive collaboration between the international virologist community and NCBI staff virologists. A panel of viral genomes advisors has been established. For more information please see: RefSeq Collaborations: http://www.ncbi.nlm.nih.gov/RefSeq/collaborators.html Viral Genome Advisors: http://www.ncbi.nlm.nih.gov/PMGifs/Genomes/viradvisors.html Microbial Contributors: http://www.ncbi.nlm.nih.gov/RefSeq/microbialcontrib.html 2.5 Release Catalog ------------------- The Release Catalog documents the full contents of the RefSeq Release. The catalog can be used to identify data of interest. See the format description in section 3.5 for additional information. The release catalog is available at: ftp://ftp.ncbi.nih.gov/refseq/release/release-catalog/RefSeq-release#.catalog The catalog for previous releases is available in the archive directory: ftp://ftp.ncbi.nih.gov/refseq/release/release-catalog/archive/ 2.6 Changes since the previous release -------------------------------------- RefSeq Release 23: There are no major changes in annotation format or features annotated with this release. ============================================================================= 3. ORGANIZATION OF DATA FILES ============================================================================= 3.1 FTP Site Organization ------------------------- RefSeq releases are available on the NCBI FTP site at: ftp://ftp.ncbi.nih.gov/refseq/release/ Documentation Directories and Files: ------------------------------------ release-catalog/ archive/ --subdirectory, archive of previous catalogs RefSeq-release#.catalog --file, comprehensive list of sequence records included in the current release release#.files.installed --file, list of sequence data files installed release#.removed-records --file, list of removed records that were included the previous release release#.taxon.new --file, list of organisms that have been added to the release since the previous release release#.taxon.update --file, list of organisms for which there has been a change in either the NCBI Tax ID or the organism name. release-notes/ archive/ --subdirectory, archive of previous documentation RefSeq-release#.txt --file, this Release notes document release-statistics/ archive/ --subdirectory, archive of previous documentation RefSeq-release#.MMDDYYYY.stats.txt --file, release statistics Sequence Data Directories and Files: ------------------------------------ The RefSeq collection is provided in a redundant fashion to best meet the needs of those who want the full collection as well as those who want a specific sub-set of the collection. Therefore the collection is provided as: 1) the complete collection, and 2) sections as defined by major taxonomic or other logical groupings. A subdirectory exists for each sub-section as follows: fungi invertebrate microbial mitochondrion plant plasmid plastid protozoa vertebrate_mammalian vertebrate_other viral In addition, the complete collection is available without these sub-groupings in the subdirectory: complete Note that this directory structure intentionally provides the release data in a redundant fashion. We gave considerable thought to how to package the release to meet the needs of different user groups. For instance, some groups may be interested in retrieving the complete protein set, while other groups may be interested in retrieving data for a more limited number of organisms. We decided to provide logical groupings based on general taxonomic node (viral, mammalian etc) as well as logical molecule type compartmentalization (e.g., plastid). Thus, all records are provided at least twice, once in the "complete" directory, and a second time in one of the other directories. Some sequences may be provided three times when it is logical to include the record in more than one additional directory. For example, a sequence may be provided in the "complete", "mitochondrion", and "vertebrate_mammalian" directories. We are interested in hearing if you find this structure useful or if you would like information grouped in a different manner. Send suggestions or comments to the NCBI Help Desk at: info@ncbi.nlm.nih.gov 3.2 Release Contents -------------------- A comprehensive list of sequence files provided for the current release is available in: ftp://ftp.ncbi.nih.gov/refseq/release/release-catalog/release#.files.installed A comprehensive list of sequence records included in the current release is available in: ftp://ftp.ncbi.nih.gov/refseq/release/release-catalog/release#.catalog File name format indicates the directory node, molecule type, and format type. Multiple files may be provided for any given molecule and format type and file names include a numerical increment. Files with the same numerical increment are related by content, they are all derived from the same ASN.1 file. Name format: complete10.bna.gz |-------|--|---|--| 1 2 3 4 1. directory location 2. numerical increment 3. format type 4. compression Note that for some molecule and format types, a number increment is skipped. This is not an error. The RefSeq release processing first produces a set of split ASN.1 files which are used to export the records by molecule and format type. If an ASN.1 file does not include any records for a given molecule type, such as genomic sequence data, then the corresponding 'genomic' fasta and flatfile records will not be found. 3.3 File Names and Formats -------------------------- File names are informative, and indicate the content, molecule type, and file format of each RefSeq release data file. Most filenames utilize this structure: directoryfilenumber.molecule.format.gz 1 2 3 4 File Name Key: 1. directory directory level the file is provided in (e.g.,complete, viral etc) 2. file number: large data sets are provided as incrementally numbered files 3. molecule type of molecule (genomic, rna, or protein); not relevant for ASN.1 format files provided in the "complete" sub-directory 4. format the data format provided in the file; see below For example: complete1.genomic.bna.gz vertebrate_mammalian2.protein.gpff.gz RefSeq Whole Genome Shotgun (WGS) data are provided in files provided per WGS project. Their filenames use a slightly different structure: directoryWGSproject.molecule.format.gz For example: completeNZ_AAAU.bna.gz microbialNZ_AAAV.genomic.fna.gz All RefSeq release files have been compressed with the gzip utility; therefore, an invariant ".gz" suffix is present for all release files. The data that comprises a RefSeq release are available in several file formats, as indicated by the format component in the file name: bna binary ASN.1 format; includes nucleotide and protein gbff GenBank flat file format; nucleotide records gpff GenPept flat file format; protein records fna FASTA format; nucleotide records faa FASTA format; protein records The comprehensive full release is deposited in the "complete" directory and is available in all file types. Binary ASN.1 format is only provided in the complete directory. The remaining directories include all of the remaining file types. The DDBJ/EMBL/GenBank and GenPept flat file format provided in this release matches that seen when accessing the records using the NCBI web site. Notably, some RefSeq record are in the CON division and do not instantiate the sequence on the flat file display, instead a 'join' statement is provided to indicate the assembly instructions. The FASTA files do include the assembled sequences for these CON division RefSeq records. For example, see NC_000022. Suggestions regarding the structure of the RefSeq release product and the available formats may be sent to the NCBI Help Desk: info@ncbi.nlm.nih.gov 3.4 File Sizes -------------- RefSeq release files are provided in a range of sizes. Most are limited to several hundred megabytes. However, some of the genomic FASTA files can exceed 2Gb. Files are compressed to reduce file size and facilitate FTP retrieval. The total size of release 23 is as follows: Extension Size (GB) Type ----------------------------------------------------------- bna 31.36 ASN.1 gbff 55.73 GenBank flat file gpff 24.04 GenPept flat file fna 166.39 FASTA, nucleotide faa 2.95 FASTA, protein Notes: [A] The compete directory provides all file types. The ASN.1 format is only available in the complete directory; the file sizes reported for the remaining file formats represents the redundant total found in the complete plus other directories. 3.5 Statistics --------------- RefSeq release 23 includes sequences from 4300 different organisms. The number of species represented in each Release sub-directory, determined by counting distinct tax IDs, is as follows: complete 4300 fungi 77 invertebrate 266 microbial 1115 mitochondrion 1143 plant 100 plasmid 531 plastid 105 protozoa 82 vertebrate_mammalian 215 vertebrate_other 555 viral 1849 Total Number of Accessions and Length (number of nucleotides or amino acids), per type of molecule: Counts of accessions and basepairs/residues per molecule type: Accessions Basepairs/Residues Genomic: 846100 81401628980 RNA: 1008695 1746698130 Protein: 3648590 1291050995 Complete RefSeq release statistics for each directory are provided in a separate document. Please see: ftp://ftp.ncbi.nih.gov/refseq/release/release-statistics/ file: RefSeq-release#.MMDDYYYY.stats.txt #: indicates release number MMDDYY: indicates release date as month,day,year Statistics for previous releases are available in the archive subdirectory: ftp://ftp.ncbi.nih.gov/refseq/release/release-statistics/archive/ 3.6 Release Catalog Format -------------------------- The full non-redundant contents of the release are documented in the release catalog. Available at: ftp://ftp.ncbi.nih.gov/refseq/release/release-catalog/ The catalog includes the following columns: 1. tax_id 2. species name 3. RefSeq accession.version 4. gi 5. FTP directories data is provided in 6. RefSeq status code 7. sequence length Note: the molecule type for each catalog entry can be inferred from the accession prefix (see below). RefSeq Status Codes are documented on the RefSeq web site. The catalog includes the following terms: na Not Applicable; status codes are not provided for some genomic records UNKNOWN The status code has not yet been applied REVIEWED The RefSeq record has been the reviewed by NCBI staff or by a collaborator. Some RefSeq records may incorporate expanded sequence and annotation information including additional publications and features. VALIDATED The RefSeq record has undergone an initial review to provide the preferred sequence standard. The record has not yet been subject to final review at which time additional functional information may be provided. PROVISIONAL The RefSeq record has not yet been subject to individual review and is thought to be well supported and to represent a valid transcript and protein. PREDICTED The RefSeq transcript may represent an ab initio prediction or may be partially supported by other transcript data; the protein is predicted. INFERRED The RefSeq record is inferred by genome sequence analysis. MODEL RefSeq records provided via automated processing and are not subject to individual review or revision between builds. 3.7 Removed Records ------------------- This is a report of accessions that were included in the previous release but are no longer included in the current release. Available at: ftp://ftp.ncbi.nih.gov/refseq/release/release-catalog/ release#.removed-records file format The file includes the following columns: 1. tax_id 2. species name 3. RefSeq accession.version 4. gi 5. FTP directories data was provided in, in last release 6. RefSeq status code 7. sequence length 8. type of removal type options include: dead protein replaced by accession [original accession is not secondary] permanently suppressed temporarily suppressed [record may become available again in the future] 3.8 RefSeq Accession Format --------------------------- RefSeq accessions are formatted as a two letter prefix, followed by an underscore, followed by six digits or 4 letters plus eight digits. For example, NM_020236 and NZ_AABC02000001. The underscore ("_") is the primary distinguishing feature of a RefSeq accession; DDBJ/EMBL/GenBank accessions never include an underscore. The RefSeq accession prefix indicates the molecule type. Molecule Type Accession Prefix ---------------------------------------------- protein NP_; XP_; ZP_; AP_; YP_; rna NM_; NR_; XM_; XR_ genomic NC_; NG_; NT_; NW_; NZ_; NS_; AC_ Additional information is available on the RefSeq Web site: http://www.ncbi.nlm.nih.gov/RefSeq/key.html#accessions NM_ and NP__ accessions are followed by either 6-digits or 9-digits. For example: NP_123456 -or- NP_123456789 As other accession series need to be expanded, they will also be expanded by adding 3 digits with existing accessions remaining stable. 3.9 Growth of RefSeq -------------------- Release Date Species Nucleotides Amino Acids Records 1 Jun 30, 2003 2005 4672871949 263588685 1061675 2 Oct 21, 2003 2124 7745398573 286957682 1097404 3 Jan 13, 2004 2218 7992741222 294647847 1101244 4 Mar 24, 2004 2358 8175128887 318253841 1193457 5 May 3, 2004 2395 8325515623 337229387 1255613 6 July 5, 2004 2467 8696371716 365446682 1367206 7 Sep 10, 2004 2558 21072808460 405233619 1579579 8 Oct 31, 2004 2645 26814386658 430300369 1709723 9 Jan 9, 2005 2780 36786975473 470534907 1843944 10 Mar 6, 2005 2827 36893741150 482862858 1893478 11 May 8, 2005 2928 39731702362 507980644 2477893 12 Jul 10,2005 2969 43043256058 608493108 2869675 13 Sep 11, 2005 3060 44727484853 686768902 3400773 14 Nov 20, 2005 3198 47364955367 763761075 3272776 15 Jan 1, 2006 3244 52645441913 810009733 3436263 16 Mar 11, 2006 3397 56175443059 887509001 3715260 17 May 1, 2006 3497 62130037371 927587669 3999859 18 July 11, 2006 3695 70474041999 974374765 4186692 19 Sep 10, 2006 3774 70694879544 1012985077 4311543 20 Nov 5, 2006 3919 72679681505 1061797276 4567569 21 Jan 6, 2007 4079 73864990566 1144795927 4742335 22 Mar 5, 2007 4187 82441128546 1215085694 5207865 23 May 8, 2007 4300 83148327110 1291050995 5503385 ============================================================================= 4. FLAT FILE ANNOTATION ============================================================================= 4.1 Main features of RefSeq Flat File ------------------------------------- Also see the RefSeq web site and the NCBI Handbook, RefSeq chapter. http://www.ncbi.nlm.nih.gov/RefSeq/ http://www.ncbi.nlm.nih.gov/books/bv.fcgi?call=bv.View..ShowTOC &rid=handbook.TOC&depth=2 4.1.1 LOCUS, DEFLINE, ACCESSION, KEYWORDS, SOURCE, ORGANISM -------------------------------------------------------------------- The beginning of each RefSeq records provides information about the accession, length, molecule type, division, and last update date. This is followed by the descriptive DEFINITION line, then by the Accession, version,and GI data, followed by detailed information about the organism and taxomonic lineage. // LOCUS NC_004916 384518 bp DNA linear INV 26-JUN-2003 DEFINITION Leishmania major chromosome 3, complete sequence. ACCESSION NC_004916 VERSION NC_004916.1 GI:32189699 KEYWORDS . SOURCE Leishmania major ORGANISM Leishmania major Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Leishmania. // Note: Both the GI and VERSION number increment when a sequence is updated, while the ACCESSION remains the same. The GI and "ACCESSION.VERSION" identifiers provide the finest resolution reference to a sequence. 4.1.2 REFERENCE, DIRECT SUBMISSION, COMMENT ------------------------------------------- REFERENCE: While the majority of RefSeq records do include REFERENCE data, this data is not required and some records do not include any citations. Publications are propagated from the GenBank record(s) from which the RefSeq is derived, provided by collaborating groups and NCBI staff during the curation process, and provided by the National Library of Medicine (NLM) PubMed MeSH indexing staff as they add new articles to PubMed. Functionally relevant citations are added by individual scientists using the Entrez Gene GeneRIF submission form, and a significant volume of citation connections are supplied by the NLM MeSH indexing staff for human, mouse, rat, zebrafish,and cow. This functionality is expected to increase in the future to treat all organisms represented in the RefSeq collection. Citations supplied by the MeSH indexers and individual scientists can be identified by the presence of a REMARK beginning with the text string "GeneRIF". This represents a significant method to keep sequence connections to the literature up-to-date; GeneRIFs add considerable value to the RefSeq collection. For more information on GeneRIFs please see: http://www.ncbi.nlm.nih.gov/projects/GeneRIF/GeneRIFhelp.html For example, several GeneRIFs have been added to NM_000173.1 including: // REFERENCE 13 (bases 1 to 2480) AUTHORS Poujol,C., Ware,J., Nieswandt,B., Nurden,A.T. and Nurden,P. TITLE Absence of GPIbalpha is responsible for aberrant membrane development during megakaryocyte maturation: ultrastructural study using a transgenic model JOURNAL Exp. Hematol. 30 (4), 352-360 (2002) MEDLINE 21935100 PUBMED 11937271 REMARK GeneRIF: Absence of GPIbalpha is responsible for aberrant membrane development during megakaryocyte maturation; leads to abnormal partitioning of the membrane systems and abnormal proplatelet production. // DIRECT SUBMISSION: A Direct Submission field is provided on some RefSeq records but not all. It is propagated from the underlying GenBank record from which the RefSeq is derived or provided on submissions from collaborating groups. Transcript and protein RefSeqs for human, mouse, rat, zebrafish, and cow do not provide this field as records often include additional data and are not necessarily direct copies of the GenBank submission. COMMENT: A COMMENT identifying the RefSeq Status is provided for the majority of the RefSeq records. This comment may include information about the RefSeq status, collaborating groups, and the GenBank records(s) from which the RefSeq is derived. The RefSeq COMMENT is not provided comprehensively in this release. We are working to supply this COMMENT more comprehensively in the future. Additional COMMENTS are provided for some records to provide information about the sequence function, notes about the aspects of curation, or comments describing transcript variants. A COMMENT is always provided if the GI has changed. For example (from NM_133490): // COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC008969.1. On Dec 31, 2002 this sequence version replaced gi:19424123. Summary: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Alternative splicing results in two transcript variants encoding distinct isoforms. Transcript Variant: This variant (2) has an alternate 3' sequence, as compared to variant 1. It encodes isoform 2 that is shorter and has a distinct C-terminus as compared to isoform 1. // 4.1.3 NUCLEOTIDE FEATURE ANNOTATION ----------------------------------- Gene, mRNA, CDS: Every effort is made to consistently provide the Gene and coding sequence (CDS) feature (when relevant). If a RefSeq is based on a GenBank record that is only annotated with the CDS, then a Gene feature is created. mRNA features are provided for most eukaryotic records; this is not yet comprehensively provided and will improve in future releases. Gene Names: Gene symbols and names are provided by external official nomenclature groups for some organisms. If official nomenclature is not available we may use a systemic name provided by the data submittor or apply a more functional name during curation. When official nomenclature is available we may provide additional alternate names for some organisms. Variation: Variation is computed by the dbSNP database staff and added via post-processing to RefSeq records. Miscellaneous: For some records, additional annotation may be provided when identified by the curation staff or provided by a collaborating group. For example, the location of polyA signal and sites may be included. 4.1.4 PROTEIN FEATURE ANNOTATION -------------------------------- Protein Names: Protein names may be provided by a collaborating group, may be based on the Gene Name, or for some records, the curation process may identify the preferred protein name based on that associated with a specific EC number or based on the literature. Protein Products: Signal peptide and mature peptide annotation is provided by propagation from the GenBank submission that the RefSeq is based on, when provided by a collaborating group, or when determined by the curation process. Domains: Domains are computed by alignment to the NCBI Conserved Domain Database database for human, mouse, rat, zebrafish, nematode, and cow. The best hits are annotated on the RefSeq. For some records, additional functionally significant regions of the protein may be annotated by the curation staff. Domain annotation is not provided comprehensively at this time. 4.2 Tracking Identifiers ------------------------ Several identifiers are provided on RefSeq records that can be used to track relationships between annotated features, relationships between RefSeq records, and changes to RefSeq records over time. The GeneID identifies the related Gene, mRNA, and CDS features. Transcript IDs (RefSeq accessions) provide an explicit connection between a transcript feature annotated on a genomic RefSeq record, and the RefSeq transcript record itself. Likewise, the Protein ID (RefSeq accessions) provides the association between the annotated CDS feature on a genomic or transcript RefSeq record, and the protein record itself. Changes to a RefSeq sequence over time can be identified by changes to the GI and version number. 4.2.1 GeneID ------------ A gene feature database cross-reference qualifier (dbxref), the GeneID, is provided on RefSeq records to support access to the Entrez Gene database. Entrez Gene provides gene-oriented information for the entire RefSeq collection. The GeneID provides a distinct tracking identifier for a gene or locus and is provided on the gene, mRNA, and CDS features. The GeneID can be used to identify a set of related features; this is especially useful when multiple products are provided to represent alternate splicing events. For example: // gene 19683..104490 /gene="DLEC1" /db_xref="GeneID:9940" <<<--- GeneID /db_xref="MIM:604050" // When viewing RefSeq records via the internet, the GeneID is hot-linked to Entrez Gene. 4.2.2 Transcript ID ------------------- The transcript_id qualifier found on a mRNA or other RNA feature annotation provides an explicit correspondance between a feature annotation on a genomic record and the RefSeq transcript record. For example: NT_011523.9 Homo sapiens chromosome 22 genomic contig. // mRNA complement(231444..239103) /gene="PKDREJ" /product="polycystic kidney disease (polycystin) and REJ (sperm receptor for egg jelly homolog, sea urchin)-like" /note="Derived by automated computational analysis using gene prediction method: BestRefseq,BLAST. Supporting evidence includes similarity to: 3 mRNAs" /transcript_id="NM_006071.1 <<<--- linked RefSeq transcript /db_xref="GI:5174632" /db_xref="GeneID:10343" /db_xref="MIM:604670" // 4.2.3 Protein ID ---------------- The protein_id qualifier found on a coding region (CDS) feature provides an explicit correspondance between feature annotation on a genomic or transcript RefSeq record and the RefSeq transcript record. For example: NC_001144.2 Saccharomyces cerevisiae chromosome XII, complete chromosome sequence. // CDS complement(16639..17613) /gene="MHT1" /locus_tag="YLL062C" /note="Mht1p; go_component: cellular_component unknown [goid 8372] [evidence ND]; go_function: homocysteine S-methyltransferase activity [goid 8898] [evidence IDA] [pmid 11013242]; go_process: sulfur amino acid metabolism [goid 96] [evidence IMP] [pmid 11013242]" /codon_start=1 /evidence=experimental /product="S-Methylmethionine Homocysteine methylTransferase" /protein_id="NP_013038.1" <<<--- linked RefSeq protein /db_xref="GI:6322966" /db_xref="SGD:S0003985" /db_xref="GeneID:850664" /translation="MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAP FTSESFWEPSSQERKVVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKR FLDKIVSFTREFIGEERYLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENF NQNRDIDLIGFETIPNFHELKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISV HIKGLGNKINKNLLLMGVNCVSFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKT WHRPTNKLDDWETTVKKFVDNGARIIGGCCRTSPKDIAEIASAVDKYS" // 4.2.4 Conserved Domain Database (CDD) ID ---------------------------------------- Protein domain annotation is calculated by the Conserved Domain Database and is included in RefSeq protein records processed for the FTP site. Domain annotation appears as a Region feature on protein records and is propagated to associated transcript features (if available) as a misc_feat. The feature annotation includes a dbxref cross-reference to the CDD database that is the equivalent of a gi identifier in that it may change over time. The dbxref retrieves a domain model as calculated at a point in time; recalculation of domains by the CDD group may result in a new CDD identifier value. The CDD dbxref values that are available in the RefSeq release, although not stable, will continue to retrieve data from the CDD database where a newer identifier value may be found. For example: VERSION NP_000550.2 GI:28302131 DEFINITION A-gamma globin [Homo sapiens]. // Region 5..142 /region_name="globin" /note="Globins are heme proteins, which bind and transport oxygen; cd01040" /db_xref="CDD:29979" <<--- CDD identifier // ============================================================================= 5. REFSEQ ADMINISTRATION ============================================================================= The National Center for Biotechnology Information (NCBI), National Library of Medicine, National Institutes of Health, is responsible for the production and distribution of the NIH RefSeq Sequence Database. NCBI distributes RefSeq sequence data by anonymous FTP. For more information, you may contact NCBI by email at info@ncbi.nlm.nih.gov or by phone at 301-496-2475. 5.1 Citing RefSeq ----------------- When citing data in RefSeq, it is appropriate to to give the sequence name, and primary accession and version number (or GI). Note, the most accurate citation of the sequence is provided by including the combined accession plus version number or the GI number. It is also appropriate to list a reference for the RefSeq project. The following on-line publication provides the most complete description and should be cited when possible: The NCBI handbook [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; 2002 Oct. Chapter 17, The Reference Sequence (RefSeq) Project. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=Books If on-line citations are not accepted by a journal, please use the following citation: NCBI Reference Sequence (RefSeq): a curated non-redundant sequence database of genomes, transcripts and proteins Pruitt KD, Tatusova, T, Maglott DR Nucleic Acids Res 2005 Jan 1;33(1):D501-D504 5.2 RefSeq Distribution Formats ------------------------------- Complete flat file releases of the RefSeq database are available via NCBI's anonymous ftp server: ftp://ftp.ncbi.nih.gov/refseq/release/ Each release is cumulative, incorporating previous data plus new data. Records that have been suppressed are not included in the release. Incremental updates that become available between RefSeq releases are available at: ftp://ftp.ncbi.nih.gov/refseq/daily ftp://ftp.ncbi.nih.gov/refseq/cumulative Please refer to the README for additional information: ftp://ftp.ncbi.nih.gov/refseq/README 5.3 Other Methods of Accessing RefSeq Data ------------------------------------------ Entrez is a molecular biology database system that presents an integrated view of DNA and protein sequence data, structure data, genome data, publications, and other data fields. The Entrez query and retrieval system is produced by the National Center for Biotechnology Information (NCBI) and is available only via the internet. Entrez is accessed at: http://www.ncbi.nlm.nih.gov/Entrez/ RefSeq entries are indexed for retrieval in the Entrez system. The web-based filter restrictions can be used to restrict your query to RefSeq data or to specific subsets of the RefSeq database. Additional specific property restrictions are provided to support querying for RefSeq records with specific STATUS codes. Queries are defined on the RefSeq web site at: http://www.ncbi.nlm.nih.gov/RefSeq/ 5.4 Request for Corrections and Comments ---------------------------------------- We welcome your suggestions to improve the RefSeq collection; we invite groups interested in contributing toward the collection and curation of the RefSeq database to improve the representation of single genes, gene families, or complete genomes to contact us. Please refer to RefSeq accession and version numbers (or GI) and the RefSeq Release number to which your comments apply; it is useful if you indicate the source of data that you found to be problematic (e.g., data on the FTP site, data retrieved on the web site), the entry DEFLINE, and the specific annotation field for which you are suggesting a change. Suggestions and corrections can be sent to: info@ncbi.nlm.nih.gov 5.5 Credits and Acknowledgements -------------------------------- This RefSeq release would not be possible without the support of numerous collaborators and the primary sequence data that is submitted by thousands of laboratories and available in GenBank. The RefSeq project is ambitious in scope and we actively welcome opportunities to work with other groups to provide this collection. We value all of our collaborators; they contribute information with a large range in scope and volume such as completely annotated genomes, advice to improve the sequence or annotation of individual RefSeq records, information about official nomenclature, and information about function. In addition to the significant information collected by collaboration, numerous NCBI staff are involved in infrastructure support, programmatic support, and curation. RefSeq is supported by 3 primary work groups that are associated with Entrez Gene, Entrez Genomes, and the Genome Annotation Pipeline. See the RefSeq web site for a list of collaborating groups and in-house staff. 5.6 Disclaimer -------------- The United States Government makes no representations or warranties regarding the content or accuracy of the information. The United States Government also makes no representations or warranties of merchantability or fitness for a particular purpose or that the use of the sequences will not infringe any patent, copyright, trademark, or other rights. The United States Government accepts no responsibility for any consequence of the receipt or use of the information. For additional information about RefSeq releases, please contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by phone at (301) 496-2475.